DPCfam | MC391611
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 87 ± 11 aa |
| Residues in low-complexity regions (%) | 0.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18332 |
| Sequences matching dominant architecture (%) | 93.94 |
| Average overlap percent | 41.8 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C9QHS5 | 635-718 | 84 | VPREKLMKGLLEGVKMSTYFPGFPTLQYLKHEIKLEKAKVKIFEQPSMYENMIITILPRKSPDLLQLAHDLLGKSVFVKWPHLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7DM50-F1 | 671-762 | 97.85 | 85.82 | View in AlphaFoldDB ↗ |