DPCfam | MC391236
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 376 ± 36 aa |
| Residues in low-complexity regions (%) | 3.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.66 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06321 |
| Sequences matching dominant architecture (%) | 3.03 |
| Average overlap percent | 34.48 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007FB249E | 2-361 | 360 | KLNKLVLVALMALGAVACDKNDGKETSKAPKSVSLKLANVKAISARSGNGVPVAPDGGTVKATISDFHVFFTDGTNLYEGKSIAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q51822-F1 | 2-381 | 99.21 | 90.10 | View in AlphaFoldDB ↗ |