DPCfam | MC391204
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 69 ± 9 aa |
| Residues in low-complexity regions (%) | 1.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.57 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01963 |
| Sequences matching dominant architecture (%) | 98.31 |
| Average overlap percent | 31.55 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B4M3U8 | 358-433 | 76 | NGIFFILLLQMSAQIAKDLGMAPGGEFRRAFEEIHKLPGCILHLGDRPIRITLYRALRALSLWQTMKLVWRLTFTD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZML4-F1 | 146-218 | 97.30 | 85.62 | View in AlphaFoldDB ↗ |