DPCfam | MC390946
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 582 ± 83 aa |
| Residues in low-complexity regions (%) | 3.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.2 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02737- PF00725- PF00378 |
| Sequences matching dominant architecture (%) | 58.62 |
| Average overlap percent | 60.31 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F5K613 | 151-827 | 676 | MHLVELIATPSTRPDILEALETFLTGVVGKGVVHAKDTPNFIANRVGVFSILAVIARAAQYKLSFDLVDDLTGSRLGRAKSATFR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O32178-F1 | 168-789 | 100.00 | 96.38 | View in AlphaFoldDB ↗ |