DPCfam | MC390570
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 318 ± 43 aa |
| Residues in low-complexity regions (%) | 3.65 |
| Residues in coiled-coil regions (%) | 0.28 |
| Predicted disordered residues (%) | 11.9 |
| Average transmembrane regions | 2.14 |
| Dominant Pfam architecture(s) | PF05024 |
| Sequences matching dominant architecture (%) | 98.98 |
| Average overlap percent | 22.3 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S9RLV5 | 123-425 | 303 | VIMYDRPHPTRMEYMSLHPISLALGDKVAALEKFGPVSDKVESEEEREKARGRLLVEKLKFHTVVKHAPSQKEQALPLIINQVNC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q466-F1 | 113-494 | 97.29 | 72.10 | View in AlphaFoldDB ↗ |