DPCfam | MC39049
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 75 ± 3 aa |
| Residues in low-complexity regions (%) | 0.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M7C1U7 | 861-931 | 71 | LQKAVHLIQEEFAFDGYLENGVEVLAMGNYIFTLKELKFDTFCDAVSEKFCDLYWDEKLLENLYKVVSGKT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q76NI1-F1 | 890-963 | 94.87 | 82.37 | View in AlphaFoldDB ↗ |