DPCfam | MC390044
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 601 |
|---|---|
| Mean domain length (aa) | 56 ± 6 aa |
| Residues in low-complexity regions (%) | 2.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00701 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 22.29 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8A0Q5 | 60-119 | 60 | EHAAGRVPVIAGVGGNSTREAIELSRHAQEVGADAGLSVVPYYNRPTQEGMYQHFRAIAE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q04796-F1 | 65-124 | 98.36 | 98.73 | View in AlphaFoldDB ↗ |