DPCfam | MC389791
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 68 ± 7 aa |
| Residues in low-complexity regions (%) | 0.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.0 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02929 |
| Sequences matching dominant architecture (%) | 99.5 |
| Average overlap percent | 24.68 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A174EXH6 | 757-826 | 70 | DNDRLPFTVIHGDVNIGVKGNGFHIIFSKQEGGIVSLVYDGREWIGKIPMPVYWRATTDNDKGNKFSVSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P24131-F1 | 725-794 | 97.22 | 95.02 | View in AlphaFoldDB ↗ |