DPCfam | MC389752
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 113 ± 20 aa |
| Residues in low-complexity regions (%) | 0.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.65 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06777 |
| Sequences matching dominant architecture (%) | 84.87 |
| Average overlap percent | 19.89 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M1VGY4 | 373-517 | 145 | NLIMEETAQRMALAVCHRLSTERRALQLASDRLVSLLWALEISDVAAFSPLQKLSDFCTLLGTYSAGFVVINDPEERIFHLACLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7KVP9-F1 | 373-487 | 99.14 | 87.89 | View in AlphaFoldDB ↗ |