DPCfam | MC389538
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 136 ± 12 aa |
| Residues in low-complexity regions (%) | 1.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.0 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF13527 |
| Sequences matching dominant architecture (%) | 0.92 |
| Average overlap percent | 6.12 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009F70D01 | 73-217 | 144 | IRKLNLSNEEDLEFIKRMVLSRKPISGQFGVSNNQGLFMFYALNVFPESIYYSREDEAIIVYQQEGHTLHLYDVVSQSDVHINSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GPD4-F1 | 148-288 | 100.00 | 95.04 | View in AlphaFoldDB ↗ |