DPCfam | MC389346
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 701 |
|---|---|
| Mean domain length (aa) | 84 ± 11 aa |
| Residues in low-complexity regions (%) | 1.42 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 21.52 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF03372 |
| Sequences matching dominant architecture (%) | 72.91 |
| Average overlap percent | 24.54 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A060WNS0 | 199-276 | 78 | DFRVHIITWNVGGAMPPDDITALLGLHVGDGNTDMYIIGLQEVNSMINKRLKDVLFTDQWSDACMERLSPFGYILVTS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044R8U2-F1 | 462-537 | 96.10 | 85.82 | View in AlphaFoldDB ↗ |