DPCfam | MC38931
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 168 ± 11 aa |
| Residues in low-complexity regions (%) | 1.7 |
| Residues in coiled-coil regions (%) | 0.27 |
| Predicted disordered residues (%) | 22.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V4VMP0 | 569-743 | 175 | IAPLYYRHGETALPHEWIEKMKESICSLAPVFNTNRMVVEYWEKLYRPAAARGLQFTENNCVLARCVADYKQFIRKNWHQVQFEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7U078-F1 | 693-860 | 99.40 | 93.50 | View in AlphaFoldDB ↗ |