DPCfam | MC38910
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 79 ± 13 aa |
| Residues in low-complexity regions (%) | 31.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.13 |
| Average transmembrane regions | 1.51 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008341F8F | 3-76 | 74 | RAIPIVEAVASLALVVVAVSCWLAGVQTTHFGPMHENAPSYESTSYSGPWIVAASVAFMVAAVLAIDIYRRFRG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F7J7-F1 | 4-82 | 92.94 | 96.85 | View in AlphaFoldDB ↗ |