DPCfam | MC388871
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1111 |
|---|---|
| Mean domain length (aa) | 118 ± 16 aa |
| Residues in low-complexity regions (%) | 1.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.17 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01242 |
| Sequences matching dominant architecture (%) | 96.33 |
| Average overlap percent | 91.84 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F5AKB0 | 8-110 | 103 | RDKFSAAHYLKEYKGKCERVHGHTFQVEVEIAVRELDRTGIGFDFTEVKKALAAALPDHTFLNEVFPFNPSAENIARHLYNELKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q03393-F1 | 16-138 | 98.23 | 98.17 | View in AlphaFoldDB ↗ |