DPCfam | MC388734
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 731 |
|---|---|
| Mean domain length (aa) | 104 ± 16 aa |
| Residues in low-complexity regions (%) | 1.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.91 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF00338 |
| Sequences matching dominant architecture (%) | 96.9 |
| Average overlap percent | 85.97 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A7SYK3 | 6-114 | 109 | YSLISVKVKGSDEAVLKSYTHFVTRAANLLNIDISGRYSIQRATHILYTLLKSPHIYKKHRAQYEIRTHGRMLQLKNLTCNTADV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P55828-F1 | 20-118 | 98.10 | 90.09 | View in AlphaFoldDB ↗ |