DPCfam | MC388390
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2351 |
|---|---|
| Mean domain length (aa) | 122 ± 18 aa |
| Residues in low-complexity regions (%) | 1.41 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 23.81 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF12776 |
| Sequences matching dominant architecture (%) | 78.33 |
| Average overlap percent | 72.04 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K5W3Z8 | 22-152 | 131 | CNRAIWTPEDDKILMDVLLEARSRGEAYGSPRCIVWRRAAIKVNAESTGKYGAAKTAMRCFGHFRALKDRFLDFCRLRNQPGIGW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7KIC8-F1 | 19-147 | 98.39 | 84.93 | View in AlphaFoldDB ↗ |