DPCfam | MC388012
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 258 ± 21 aa |
| Residues in low-complexity regions (%) | 3.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.22 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05317 |
| Sequences matching dominant architecture (%) | 99.04 |
| Average overlap percent | 92.08 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A8ME13 | 26-284 | 259 | VGVSDNGTAELWNGSIIHYSYHVNAVMGYLTLYNASFTIISLAASGNVASIQLNLVVTNGIEYFWVQNIAHIGEFNGSRYMVWFW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P17118-F1 | 54-318 | 98.09 | 96.80 | View in AlphaFoldDB ↗ |