DPCfam | MC387890
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 741 |
|---|---|
| Mean domain length (aa) | 422 ± 61 aa |
| Residues in low-complexity regions (%) | 4.91 |
| Residues in coiled-coil regions (%) | 0.93 |
| Predicted disordered residues (%) | 22.5 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF00221 |
| Sequences matching dominant architecture (%) | 93.46 |
| Average overlap percent | 95.6 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q5ZVR0 | 29-475 | 447 | LAENSFELIRASHQTVKKVIDEKKTVYGINTGFGSLANQTISSDCLKELQRNIVLSHACGTGKLLPDDVVALILLLKINNLSQGY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8RBH4-F1 | 25-452 | 99.28 | 96.18 | View in AlphaFoldDB ↗ |