DPCfam | MC387195
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Residues in low-complexity regions (%) | 1.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.66 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G1FXJ6 | 325-415 | 91 | KWCCNCPKCLFTYLVLYPFLAKKDLHQIFGQDLFENKALLPIMCSLLGQACPPKLGERRRRTHKPFECVGTYKESCLAVKLSLKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C4RJF8-F1 | 327-400 | 97.37 | 92.50 | View in AlphaFoldDB ↗ |