DPCfam | MC387156
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Residues in low-complexity regions (%) | 5.92 |
| Residues in coiled-coil regions (%) | 1.67 |
| Predicted disordered residues (%) | 15.4 |
| Average transmembrane regions | 0.6 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00090098E6 | 146-261 | 116 | SVEHRAKSFELPLSLRMIKKKQQWEVGVRGLEEMSCCSVRKAFSSMVFIIVELQSKALQMREALCDEELELIVSKVQREMHLSFA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1N026-F1 | 144-257 | 99.14 | 69.60 | View in AlphaFoldDB ↗ |