DPCfam | MC387122
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 100 ± 16 aa |
| Residues in low-complexity regions (%) | 15.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.24 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF00300 |
| Sequences matching dominant architecture (%) | 0.59 |
| Average overlap percent | 21.48 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A024M2Q3 | 1-102 | 102 | MQTAVRSYFTAGVALAGAGVIAVSPVAPTPTDIGLPAIHASSAAVTLNALTNPLDAWVQTLTKAGTNLQALGEQLMASPAPILQT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8FF47-F1 | 59-115 | 57.58 | 37.42 | View in AlphaFoldDB ↗ |