DPCfam | MC386879
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 123 ± 15 aa |
| Residues in low-complexity regions (%) | 1.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09673 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 83.55 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E5G5L5 | 46-150 | 105 | SCFSPLSYCFHPSSFGALIRGVLPEGFPATAKRIESLIRSPNQAPIQSGFSISPDWFKQFDITKVPAFVSVKSGRCLPEQPCSNA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3H1D8-F1 | 83-191 | 98.32 | 93.78 | View in AlphaFoldDB ↗ |