DPCfam | MC386708
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Residues in low-complexity regions (%) | 1.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00637 |
| Sequences matching dominant architecture (%) | 96.84 |
| Average overlap percent | 51.14 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E5SVW3 | 783-855 | 73 | FSEHRNLQNLLILTAIRADRPRVMEYVQRLENYDAPDIANLAITSELYEEAFAIYKKFDVNTSAIKVLIDNIG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1LMS9-F1 | 1032-1103 | 100.00 | 74.00 | View in AlphaFoldDB ↗ |