DPCfam | MC386560
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Residues in low-complexity regions (%) | 7.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.94 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF01355 |
| Sequences matching dominant architecture (%) | 83.68 |
| Average overlap percent | 63.35 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1H5UA52 | 6-97 | 91 | RTFLIMACTLPVTPFISHKALAAFPPLSERSAQAKARHYKSNVRRVRHPKYKKGQTCSNCQFFKFLDSGCQLFSSNSVAPAGWCQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8XUU7-F1 | 4-102 | 98.92 | 87.59 | View in AlphaFoldDB ↗ |