DPCfam | MC386165
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1211 |
|---|---|
| Mean domain length (aa) | 93 ± 15 aa |
| Residues in low-complexity regions (%) | 1.9 |
| Residues in coiled-coil regions (%) | 0.22 |
| Predicted disordered residues (%) | 15.37 |
| Average transmembrane regions | 0.15 |
| Dominant Pfam architecture(s) | PF00494 |
| Sequences matching dominant architecture (%) | 99.81 |
| Average overlap percent | 37.94 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H8FVP9 | 107-200 | 94 | ELLNAFRRDALRNYCTDWSDLMSYCRSSAAPVGRFLLTLHGESPETFPANDALCAALQVLNHLQDCGKDLRELNRVYVPVDLLTA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P37271-F1 | 229-325 | 98.85 | 95.58 | View in AlphaFoldDB ↗ |