DPCfam | MC386006
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Residues in low-complexity regions (%) | 3.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.2 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF10433 |
| Sequences matching dominant architecture (%) | 76.64 |
| Average overlap percent | 19.53 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A061HB25 | 167-264 | 98 | LAVDPASRCAALLLPQDAIAVLPFYQDMSDLDFYDIDQGTDGVDVDPIETLPYSPSFVLAFQEVDAKIRDVKDFCFLPGFQKPTV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IC37-F1 | 139-230 | 100.00 | 82.30 | View in AlphaFoldDB ↗ |