DPCfam | MC386
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 410 ± 29 aa |
| Residues in low-complexity regions (%) | 2.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.43 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11308 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 6.19 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B5S411 | 45-444 | 400 | NFTFDVNPETGEIFVEKDGVRESASLPLSKKKITNLIKKDDCISWSYPDDQIDVKIEKKESYLNIKLKSTKSEGANEFTWPKVSA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ENQ5-F1 | 55-286 | 57.11 | 97.07 | View in AlphaFoldDB ↗ |