DPCfam | MC385203
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 426 ± 50 aa |
| Residues in low-complexity regions (%) | 10.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.73 |
| Average transmembrane regions | 3.84 |
| Dominant Pfam architecture(s) | PF00027 |
| Sequences matching dominant architecture (%) | 43.75 |
| Average overlap percent | 5.18 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V5PCA6 | 58-456 | 399 | WMRDDEVVIYLGQRHAMELLRRALLPALGFIALLVLMFVVAQTRLGWGGLALLSLPALLLGGLLAWDYVDWHDDRFVLTTQRVMH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9CCL2-F1 | 8-159 | 33.63 | 58.00 | View in AlphaFoldDB ↗ |