DPCfam | MC385105
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 147 ± 17 aa |
| Residues in low-complexity regions (%) | 6.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 44.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14383 |
| Sequences matching dominant architecture (%) | 92.0 |
| Average overlap percent | 12.54 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B6TPW5 | 10-124 | 115 | DFLRRLLCARSAGDRPDAAARHTCAPETDDEPTRSPCIVARLMGLDAMPPEASHAQPPRTPLLRRSRSAEGSPRQCEWDRDNTQP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7KA67-F1 | 31-189 | 98.68 | 64.29 | View in AlphaFoldDB ↗ |