DPCfam | MC385096
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Residues in low-complexity regions (%) | 1.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02200 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 24.94 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A166R566 | 296-372 | 77 | PKSPFLDLLFKYQCIRTQKKQKVFYWFSVPHDRLFLDALERDLKREKMGLEPTTAITGEPALSFVYDSKKSLYEQFS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q489-F1 | 120-196 | 100.00 | 90.13 | View in AlphaFoldDB ↗ |