DPCfam | MC384922
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 96 ± 20 aa |
| Residues in low-complexity regions (%) | 1.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.7 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF12851 |
| Sequences matching dominant architecture (%) | 6.35 |
| Average overlap percent | 38.11 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A165JUR5 | 1-93 | 93 | FLGRSLIFNRSTTLHIDDKDPKGNLTPILTVGRYTTGTLHIPELGLKAAYNSGTLGMLRGALLAHEVTFDGGQRVAVAHFMHTSM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P86938-F1 | 179-289 | 55.62 | 92.95 | View in AlphaFoldDB ↗ |