DPCfam | MC384921
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 64 ± 7 aa |
| Residues in low-complexity regions (%) | 0.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 0.63 |
| Average transmembrane regions | 1.5 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00084B1EAA | 202-267 | 66 | LAYLNYKGNIWQILKSFYFMLEIVNTIPFVLTICYPPLRNLFLPAFLNCWLAKHALENMFNDLHRA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8QFV0-F1 | 173-238 | 100.00 | 81.90 | View in AlphaFoldDB ↗ |