DPCfam | MC384882
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 512 ± 61 aa |
| Residues in low-complexity regions (%) | 3.51 |
| Residues in coiled-coil regions (%) | 2.5 |
| Predicted disordered residues (%) | 21.53 |
| Average transmembrane regions | 0.13 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P7B0E0 | 67-537 | 471 | ERDQPYNTHTCKAFIRKCFQVVTKNKNIVTGLLSMLPNDLYGSVISGGFSVILAAVESHVNMRTEIQAALASIPQKLDNVQRTSE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GQG6-F1 | 120-627 | 96.12 | 81.25 | View in AlphaFoldDB ↗ |