DPCfam | MC3846
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 152 ± 21 aa |
| Residues in low-complexity regions (%) | 4.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.23 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF14381 |
| Sequences matching dominant architecture (%) | 99.03 |
| Average overlap percent | 43.8 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q7XPL1 | 99-268 | 170 | GGGGRETWVRRAREGYYLQLSLAIRLTSEAFLAGVPPELLIGCGGGGEAENHADVAADAAAVSYRLWVNGCLSWGDKIAHGFYNI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0EQY1-F1 | 120-279 | 100.00 | 73.38 | View in AlphaFoldDB ↗ |