DPCfam | MC384588
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 165 ± 21 aa |
| Residues in low-complexity regions (%) | 3.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1R3JEQ7 | 504-659 | 156 | IIGGTCGQPFVLSQPFLHSISKSPFPRNTGKRAANFSAWLHERKNDLMEGGINLTEDLQCGDIFHLISLVSSGELSVIPCLPDEG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7N0H8-F1 | 1316-1472 | 97.52 | 63.99 | View in AlphaFoldDB ↗ |