DPCfam | MC384476
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Residues in low-complexity regions (%) | 1.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13385 |
| Sequences matching dominant architecture (%) | 31.62 |
| Average overlap percent | 2.28 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I3K457 | 186-249 | 64 | DLLVDMLGVMASYSITVKELKLLFSMLRGENGIWPRHAIKLLSVLNQMPQRHGPDTFFNFPGRS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8RXQ7-F1 | 69-134 | 98.51 | 89.91 | View in AlphaFoldDB ↗ |