DPCfam | MC383878
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Residues in low-complexity regions (%) | 3.02 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.83 |
| Average transmembrane regions | 1.47 |
| Dominant Pfam architecture(s) | PF02386 |
| Sequences matching dominant architecture (%) | 98.34 |
| Average overlap percent | 22.38 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F9GJF9 | 217-290 | 74 | CHSFSTISSGGFSTQTSNIGGYNSLFIEMTLIIFMILGTTNFALHYSFLQKDWLAYWKSFELRLYLGVLLVAIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5FA04-F1 | 204-286 | 96.47 | 94.33 | View in AlphaFoldDB ↗ |