DPCfam | MC383698
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1391 |
|---|---|
| Mean domain length (aa) | 1399 ± 281 aa |
| Residues in low-complexity regions (%) | 2.73 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 26.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01835- PF00207- PF17973 |
| Sequences matching dominant architecture (%) | 14.92 |
| Average overlap percent | 80.51 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q3MSI2 | 247-1485 | 1239 | INVSKIGLVTKSGAKRGLCFVTDLSTGAPVDGADLSLAVNGGMKSLGKASPDGTLSFDLPDADRNLVMARKGSSVAVVDFYSSSN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GRN4-F1 | 260-1634 | 99.15 | 84.43 | View in AlphaFoldDB ↗ |