DPCfam | MC383608
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 236 ± 51 aa |
| Residues in low-complexity regions (%) | 1.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.51 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02765- PF16686 |
| Sequences matching dominant architecture (%) | 51.12 |
| Average overlap percent | 81.59 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A010QZ92 | 59-234 | 176 | VNVIGLVKDFRRPIVTTGKDYKCQMSLIDMSLSNESEGQDVNLVIFRPPGDMPTVKSGDVVVAHQVKTQRYRSDPLSLLSHFSTT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P62597-F1 | 155-389 | 99.59 | 91.04 | View in AlphaFoldDB ↗ |