DPCfam | MC383480
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 661 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Residues in low-complexity regions (%) | 1.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.07 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF03551 |
| Sequences matching dominant architecture (%) | 0.45 |
| Average overlap percent | 52.13 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X7AJ93 | 11-102 | 92 | AEEFGSADAAAIVYNLRHWLTVNKEKAQNIHDGRVWTYNSLDSFIELFPWLSRDQIKRHFLRLEQHGILLKGNYNRNSFDKTAWY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F9B5-F1 | 12-105 | 98.00 | 91.15 | View in AlphaFoldDB ↗ |