DPCfam | MC383033
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Residues in low-complexity regions (%) | 13.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 56.38 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13637- PF12796 |
| Sequences matching dominant architecture (%) | 1.64 |
| Average overlap percent | 38.36 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A060Y5V0 | 352-432 | 81 | VIIQADDLPDIPPQTVTEEQYMDEQGNMVVKKITRKVIRKYFSPDGVEREEVTVQGSQQEMVSVEEGDGFSKVVKRTVVRS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P16157-F1 | 1796-1878 | 95.24 | 31.37 | View in AlphaFoldDB ↗ |