DPCfam | MC382837
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 226 ± 21 aa |
| Residues in low-complexity regions (%) | 5.25 |
| Residues in coiled-coil regions (%) | 6.5 |
| Predicted disordered residues (%) | 24.4 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04389 |
| Sequences matching dominant architecture (%) | 86.76 |
| Average overlap percent | 21.49 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A068T1H7 | 332-571 | 240 | MTETEAFLSDVIEEVAGKKAEAERPHRAGDYSFNNIGLSSYLMLSSTMTERDREEKGYYTVGGCGANIAWHTENDTLEIADKDIM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9UQQ1-F1 | 533-731 | 77.54 | 95.59 | View in AlphaFoldDB ↗ |