DPCfam | MC38237
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Residues in low-complexity regions (%) | 1.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.48 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF12202 |
| Sequences matching dominant architecture (%) | 1.67 |
| Average overlap percent | 50.85 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007663918 | 341-397 | 57 | LTLLLVLEDRLHRQLTYDLLPTDSAQDLAAELVHYGFVHEDDRTKLAAFLESTFLKY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9Y0Y6-F1 | 513-567 | 91.67 | 87.88 | View in AlphaFoldDB ↗ |