DPCfam | MC382066
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 64 ± 8 aa |
| Residues in low-complexity regions (%) | 1.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.21 |
| Average transmembrane regions | 1.08 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B1K2W9 | 21-80 | 60 | RDYNAWVGDETLEDYALRFTPRSFRRWSELRVANTAIGAVSFLVLEAIGGSLVVNYGFTN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8FGV8-F1 | 22-78 | 89.06 | 84.94 | View in AlphaFoldDB ↗ |