DPCfam | MC381908
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 117 ± 20 aa |
| Residues in low-complexity regions (%) | 2.13 |
| Residues in coiled-coil regions (%) | 43.89 |
| Predicted disordered residues (%) | 35.34 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00169 |
| Sequences matching dominant architecture (%) | 66.0 |
| Average overlap percent | 9.67 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| O01686 | 74-179 | 106 | QGRDLRERNQWVRILENSIRASSGYAKNVSVGTTPSQHFKQRTEEANEFLKTLVEKVKALEQLKSGERAVDEKKTIDSLIAASNN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1Z814-F1 | 98-232 | 100.00 | 67.67 | View in AlphaFoldDB ↗ |