DPCfam | MC381763
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 391 |
|---|---|
| Mean domain length (aa) | 217 ± 13 aa |
| Residues in low-complexity regions (%) | 1.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.48 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13205 |
| Sequences matching dominant architecture (%) | 92.79 |
| Average overlap percent | 45.48 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B1Y215 | 7-233 | 227 | IFIVIIALFQVSCARMGSPTGGPKDSIPPIMAIAKPANKTTSFDAEKVVIVFDEYIKFEKLNTQLIISPPMEKKPIIKPEVGVSK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-H8WEC0-F1 | 488-587 | 42.66 | 95.17 | View in AlphaFoldDB ↗ |