DPCfam | MC381721
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 386 ± 47 aa |
| Residues in low-complexity regions (%) | 1.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.68 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05359 |
| Sequences matching dominant architecture (%) | 13.13 |
| Average overlap percent | 32.76 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H1Y4W6 | 123-554 | 432 | LDISQIVISAPNLRVDYEQNRNEDTLVSNKKTPYQLISKVLKSVHVQNIMLNDVKFKYTDHSGAKPDISEFNELNFSATDFLLDS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I0D4-F1 | 138-248 | 28.72 | 88.73 | View in AlphaFoldDB ↗ |