DPCfam | MC38146
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 436 ± 51 aa |
| Residues in low-complexity regions (%) | 1.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.29 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF11678 |
| Sequences matching dominant architecture (%) | 27.42 |
| Average overlap percent | 16.97 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1K1QS59 | 57-478 | 422 | CRIPPHMPGVIIFVHGVNSTGEWYDAAEQALCQGLNERLKRSDLKANTYSTVDGDRPVPRYIKKGDEGNSPVIRFYWGYRAKDGE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I6M9-F1 | 32-411 | 85.38 | 89.10 | View in AlphaFoldDB ↗ |