DPCfam | MC381361
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Residues in low-complexity regions (%) | 1.22 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.03 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00169 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 20.03 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I1C595 | 342-401 | 60 | RTFYFYTDDENSMKSWITNLMKSTISRDLAAPVLSSRVISTVSLDVARRMRPRPPSVLIY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PRW9-F1 | 820-871 | 77.61 | 86.82 | View in AlphaFoldDB ↗ |