DPCfam | MC38126
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 931 |
|---|---|
| Mean domain length (aa) | 174 ± 22 aa |
| Residues in low-complexity regions (%) | 7.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.65 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF04366 |
| Sequences matching dominant architecture (%) | 90.44 |
| Average overlap percent | 58.96 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009EF219F | 72-215 | 144 | LDAKVMAALEQCQQTQESCGTGDPAGYLVFPDVTEVALGVGGGGGDGALVQNGQIVSYWRMGEGSVGLQAGVQAASYVFKVPDAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8PYW1-F1 | 28-197 | 95.98 | 77.59 | View in AlphaFoldDB ↗ |